PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma53g00270.1
Common NameZOSMA_53G00270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family TALE
Protein Properties Length: 479aa    MW: 53756.3 Da    PI: 6.7015
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma53g00270.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.84.4e-094084461854
                      HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      +F++  ++yp+ +e++ LA k gLt +qV++WF N R +
  Zosma53g00270.1 408 MFQNflHPYPKDNEKQLLAIKSGLTRSQVSNWFINARVR 446
                      5887779******************************88 PP

2BELL50.74.6e-17283348772
             BELL   7 kkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        k+ Lls+l+ +++rY+q+v +++ ++s+F  +++    +++ ++A +a+S  +++L++ i+ qi
  Zosma53g00270.1 283 PSKTELLSILKLIENRYSQCVTKMHGIMSAFYNMTESSIPQMHLRFAFHAVSSFYKNLRETIMTQI 348
                      5699************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.9E-6215346IPR006563POX domain
PfamPF075261.1E-19220344IPR006563POX domain
PROSITE profilePS5007111.434387450IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.0E-26389464IPR009057Homeodomain-like
SuperFamilySSF466897.7E-16390458IPR009057Homeodomain-like
SMARTSM003892.0E-6390454IPR001356Homeobox domain
CDDcd000866.68E-12390451No hitNo description
PfamPF059208.4E-15407446IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MILDTMFNTN DHESMTIDAP MSSHTSPVFS MFHQPPTNIA EDAGIPVSGY LPFVGTCSNH  60
NPAISSANNN LAPFPPDNFA TLVPSDGASC NGVFNCQYDG IPAAVHILPP SHCQSVGSSD  120
PWWSGVSVNK VNNYPSSENR FVYNYCTSGG NDLSLTLSSS SRPQLHPIPM INSCFNAPSD  180
HQFSELSCSA VTQVSEFSVD GHNNSDHSRL SSSPVYLNHV LVRSRYLHAA QQILSQAVSF  240
SLGDSDELDC QILKQETNDR RLLNTINSDQ SSSSQSCKDP MHPSKTELLS ILKLIENRYS  300
QCVTKMHGIM SAFYNMTESS IPQMHLRFAF HAVSSFYKNL RETIMTQIIF TNQQLQLSCE  360
SLSDKANLFE SSFVHKQWAL QQIKNDHHSW RPQRGLPEKS VSVLRAWMFQ NFLHPYPKDN  420
EKQLLAIKSG LTRSQVSNWF INARVRLWKP MIEEMYSEIN RKHPTEDDSI NNLRFPIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B8e-15396454563Homeobox protein Meis2
3k2a_A8e-15396454563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008793176.12e-87PREDICTED: homeobox protein ATH1-like isoform X2
SwissprotP487315e-71ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A0K9NZ680.0A0A0K9NZ68_Z
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31433365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.16e-71homeobox gene 1